Structure of PDB 6ucf Chain H Binding Site BS01

Receptor Information
>6ucf Chain H (length=226) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QEVLVQSGAEVKKPGASVKVSCRAFGYTFTGNALHWVRQAPGQGLEWLGW
INPHSGDTTTSQKFQGRVYMTRDKSINTAYLDVTRLTSDDTAIYYCARDK
YYGNEAVGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL
VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCD
Ligand information
>6ucf Chain A (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGIGAVF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ucf VRC34-Antibody Lineage Development Reveals How a Required Rare Mutation Shapes the Maturation of a Broad HIV-Neutralizing Lineage.
Resolution1.29 Å
Binding residue
(original residue number in PDB)		T30 W50 N52 H53 D56 Y97 N100 E100A A100B
Binding residue
(residue number reindexed from 1)		T30 W50 N52 H54 D57 Y101 N104 E105 A106
External links