Structure of PDB 6uce Chain H Binding Site BS01

Receptor Information
>6uce Chain H (length=228) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QEVLVQSGAEVKKPGASVKVSCKAFGYTFTGNPMHWVRQAPGQGLEWMGW
INPHSGDTTTAQKFQGRVYMTRDKSINTAYLDVTRLTSDDTAIYYCARDK
YYGNEAVGMDVWGQGTTVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC
NVNHKPSNTKVDKKVEPKSCDKGLEVLF
Ligand information
>6uce Chain C (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGIGAVF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uce VRC34-Antibody Lineage Development Reveals How a Required Rare Mutation Shapes the Maturation of a Broad HIV-Neutralizing Lineage.
Resolution1.382 Å
Binding residue
(original residue number in PDB)		T30 W50 N52 Y97 E100A A100B
Binding residue
(residue number reindexed from 1)		T30 W50 N52 Y101 E105 A106
External links