Structure of PDB 6uc5 Chain H Binding Site BS01

Receptor Information
>6uc5 Chain H (length=217) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLVKSGGVKPGGSLRLSCAVSGFTFTDAWMSWVRQAPGKGPEWVGRIKSN
PDGGTTDYAAPVRGRFTISRDDSKNTLYLQMNNLKTEDTAVYYCITDRDF
YRSGGSWGQGTLVTVVSRRLPPSVFPLAPSSKSTSGGTAALGCLVKDYFP
EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN
VNHKPSNTKVDKKVEPK
Ligand information
>6uc5 Chain P (length=11) Species: 36329 (Plasmodium falciparum 3D7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NPNANPNANPN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uc5 Diverse Antibody Responses to Conserved Structural Motifs in Plasmodium falciparum Circumsporozoite Protein.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		W33 R50 D95 R96 Y99 R100
Binding residue
(residue number reindexed from 1)		W29 R46 D97 R98 Y101 R102
Enzymatic activity
Enzyme Commision number ?
External links