Structure of PDB 6tkj Chain H Binding Site BS01

Receptor Information
>6tkj Chain H (length=249) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF
Ligand information
>6tkj Chain I (length=17) Species: 37546 (Glossina morsitans morsitans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GEPGAPIDYDEYIPGIR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tkj Sulfotyrosine-Mediated Recognition of Human Thrombin by a Tsetse Fly Anticoagulant Mimics Physiological Substrates.
Resolution2.81 Å
Binding residue
(original residue number in PDB)		H407 R409 E414 R418 L450 Q451 A452 D503 D519 A520 W547 G548 H562 F564 R565 L566 K567 K568 K572
Binding residue
(residue number reindexed from 1)		H87 R89 E94 R98 L130 Q131 A132 D175 D191 A192 W219 G220 H234 F236 R237 L238 K239 K240 K244
Enzymatic activity
Catalytic site (original residue number in PDB) H363 D419 E522 G523 D524 S525 G526
Catalytic site (residue number reindexed from 1) H43 D99 E194 G195 D196 S197 G198
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6tkj, PDBe:6tkj, PDBj:6tkj
PDBsum6tkj
PubMed33096052
UniProtP00734|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]