Structure of PDB 6tki Chain H Binding Site BS01

Receptor Information
>6tki Chain H (length=245) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRIEKISMLEKIYIHPRYNWRENLDRDIALMKLK
KPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPSVLQVVN
LPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSP
FNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFGE
Ligand information
>6tki Chain I (length=17) Species: 37546 (Glossina morsitans morsitans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GEPGAPIDYDEYIPGIR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tki Sulfotyrosine-Mediated Recognition of Human Thrombin by a Tsetse Fly Anticoagulant Mimics Physiological Substrates.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		H363 H407 R409 E414 R418 L450 Q451 A452 R490 D503 D519 A520 W547 G548 G550 H562 F564 R565 L566 K567 K568
Binding residue
(residue number reindexed from 1)		H43 H81 R83 E88 R92 L124 Q125 A126 R156 D169 D185 A186 W213 G214 G216 H228 F230 R231 L232 K233 K234
Enzymatic activity
Catalytic site (original residue number in PDB) H363 D419 E522 G523 D524 S525 G526
Catalytic site (residue number reindexed from 1) H43 D93 E188 G189 D190 S191 G192
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6tki, PDBe:6tki, PDBj:6tki
PDBsum6tki
PubMed33096052
UniProtP00734|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]