Structure of PDB 6tkh Chain H Binding Site BS01

Receptor Information

>6tkh Chain H (length=251) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF
G

Ligand information

>6tkh Chain I (length=24) Species: 37546 (Glossina morsitans morsitans)

GEPGAPIDYDEYGGTPLHEIPGIR

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6tkh Sulfotyrosine-Mediated Recognition of Human Thrombin by a Tsetse Fly Anticoagulant Mimics Physiological Substrates.
• Resolution: 1.9 Å
• Binding residue (original residue number in PDB): Y367 P369 H407 R409 E414 N415 L416 R418 R443 L450 Q451 A452 R490 I499 D503 N504 D519 A520 W547 G548 E549 G550 H562 F564 R565 K567 K568 K572
• Binding residue (residue number reindexed from 1): Y47 P49 H87 R89 E94 N95 L96 R98 R123 L130 Q131 A132 R163 I172 D176 N177 D192 A193 W220 G221 E222 G223 H235 F237 R238 K240 K241 K245

Enzymatic activity

• Catalytic site (original residue number in PDB): H363 D419 E522 G523 D524 S525 G526
• Catalytic site (residue number reindexed from 1): H43 D99 E195 G196 D197 S198 G199
• Enzyme Commision number: 3.4.21.5: thrombin.

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:6tkh, PDBe:6tkh, PDBj:6tkh
• PDBsum: 6tkh
• PubMed: 33096052
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)