Structure of PDB 6t34 Chain H Binding Site BS01

Receptor Information

>6t34 Chain H (length=207) Species: 12230 (Turnip mosaic virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PRLKSLTSKMRVPRYEKRVALNLDHLILYTPEQTDLSNTRSTRKQFDTWF
EGVMADYELTEDKMQIILNGLMVWCIENGTSPNINGMWVMMDGDDQVEFP
IKPLIDHAKPTFRQIMAHFSDVAEAYIEKRNQDRPYMPRYGLQRNLTDMS
LARYAFDFYEMTSRTPIRAREAHIQMKAAALRGANNNLFGLDGNVGTTVE
NTERHTT

Ligand information

>6t34 Chain h (length=5) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuuuu

.....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6t34 Structure of Turnip mosaic virus and its viral-like particles.
Resolution	5.2 Å
Binding residue (original residue number in PDB)	S146 N148 R178 Y205 R209 K242
Binding residue (residue number reindexed from 1)	S81 N83 R113 Y140 R144 K177

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Cellular Component
GO:0019028	viral capsid

View graph for
Cellular Component

External links

PDB	RCSB:6t34, PDBe:6t34, PDBj:6t34
PDBsum	6t34
PubMed	31659175
UniProt	A0A346TKY7

[Back to BioLiP]