Structure of PDB 6sof Chain H Binding Site BS01

Receptor Information
>6sof Chain H (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>6sof Chain G (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sof Cryo-EM structure of the complete and ligand-saturated insulin receptor ectodomain.
Resolution4.3 Å
Binding residue
(original residue number in PDB)		F1 V2 N3 Q4 H5 L6 C7 V18 R22 G23
Binding residue
(residue number reindexed from 1)		F1 V2 N3 Q4 H5 L6 C7 V18 R22 G23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6sof, PDBe:6sof, PDBj:6sof
PDBsum6sof
PubMed31727777
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]