Structure of PDB 6sh8 Chain H Binding Site BS01

Receptor Information
>6sh8 Chain H (length=312) Species: 930945 (Sulfolobus islandicus REY15A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRVLIKPLEPLMFRSQGEFEPLITGSHTAAQSLIIPRPSTIAGMLGYILF
NKSSGTGDWLSDLTNLLATIYGTFIETNGEYLFPLRMGNHLALVDQQHLI
NLPTLLEKEYERREKGIYELFYDKNKLFQIINHQDRIGISIDKSTRTVKE
HYLYSARYLAFKKEVNYVIFIDNDAISDKINGKIVNFGGENRIAKLEVDD
YKVDTSIEEEYYLALSPILIPDEALDNFLDNISDYVAMGKVDKISLGFDI
ANTKRKEMLTAILEGSIVKRSIIDFIKNEIKNDLRYRFSKYEKIGYNTLM
SLCKLALRKILS
Ligand information
>6sh8 Chain V (length=48) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auugaaaguucaaagcuuagauacccuggagggaaaccagacuuaaca
................................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sh8 Structures of the Cmr-beta Complex Reveal the Regulation of the Immunity Mechanism of Type III-B CRISPR-Cas.
Resolution3.14 Å
Binding residue
(original residue number in PDB)		R15 S16 F20 E21 P22 R38 S40 T41 G44 M45 G47 Y48 F51 I138 G139 I140 I142 R147 T148 V149 Y155 N187 G190 E191 N192 S246 G248 F249 D250 I251 K257
Binding residue
(residue number reindexed from 1)		R14 S15 F19 E20 P21 R37 S39 T40 G43 M44 G46 Y47 F50 I137 G138 I139 I141 R146 T147 V148 Y154 N186 G189 E190 N191 S245 G247 F248 D249 I250 K256
Enzymatic activity
Enzyme Commision number ?
External links