Structure of PDB 6sf6 Chain H Binding Site BS01

Receptor Information
>6sf6 Chain H (length=216) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQQSGAELAKPGASVNLSCKASGYTFTNYWVHWVKQRPGQGLEWIGY
INPSNTYISYNQQFKDKATLTADKSSSTAYMQLSRLTYEDSSVYYCARGG
FFYDYDVWYFDVWGTGTTVTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYF
PEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCN
VAHPASSTKVDKKIVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sf6 Antibodies to cartilage oligomeric matrix protein in vivo are pathogenic and clinically relevant in rheumatoid arthritis
Resolution1.9 Å
Binding residue
(original residue number in PDB)		W33 Y50 N55 Y57 S59 G99 Y103 Y105 W108
Binding residue
(residue number reindexed from 1)		W33 Y50 N55 Y57 S59 G99 Y103 Y105 W108
External links