Structure of PDB 6r86 Chain H Binding Site BS01

Receptor Information
>6r86 Chain H (length=296) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>6r86 Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6r86 Structure and function of Vms1 and Arb1 in RQC and mitochondrial proteome homeostasis.
Resolution3.4 Å
Binding residue
(original residue number in PDB)
A2 S13 S14 F16 T18 F20 R21 R22 R24 T28 Y30 R33 R50 V52 R54 T56 N57 K58 I61 Q63 I69 D72 V74 Y79 H90 G91 N94 Q151 R152 T155 G156 A157 R158 Y198 H203 Y207 E210 R218 T256 K258 K259 K262 Y265 A266 E268 S269 Y272 Q274 K276 K279 R282 R285
Binding residue
(residue number reindexed from 1)
A1 S12 S13 F15 T17 F19 R20 R21 R23 T27 Y29 R32 R49 V51 R53 T55 N56 K57 I60 Q62 I68 D71 V73 Y78 H89 G90 N93 Q150 R151 T154 G155 A156 R157 Y197 H202 Y206 E209 R217 T255 K257 K258 K261 Y264 A265 E267 S268 Y271 Q273 K275 K278 R281 R284
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6r86, PDBe:6r86, PDBj:6r86
PDBsum6r86
PubMed31189955
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]