Structure of PDB 6ppn Chain H Binding Site BS01

Receptor Information
>6ppn Chain H (length=94) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSLADFMEQRVQVITNDGRVVLGSLKGFDHTTNLILSDSFERIISMDQDM
ETIPLGVYLLRGENVAMVGLVNEELDSEIEWTKIRGEAIPDVVH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ppn Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
Resolution1.91 Å
Binding residue
(original residue number in PDB)		T31 T32 N33 R61 G62 E63
Binding residue
(residue number reindexed from 1)		T31 T32 N33 R61 G62 E63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0030620 U2 snRNA binding
GO:0140691 RNA folding chaperone
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0034337 RNA folding
GO:1905323 telomerase holoenzyme complex assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005686 U2 snRNP
GO:0005688 U6 snRNP
GO:0005697 telomerase holoenzyme complex
GO:0032991 protein-containing complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071011 precatalytic spliceosome
GO:0120115 Lsm2-8 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ppn, PDBe:6ppn, PDBj:6ppn
PDBsum6ppn
PubMed32518066
UniProtO74483|LSM8_SCHPO U6 snRNA-associated Sm-like protein LSm8 (Gene Name=lsm8)

[Back to BioLiP]