Structure of PDB 6pdr Chain H Binding Site BS01

Receptor Information
>6pdr Chain H (length=213) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EFQLQQSGPELVKPGASVKISCKASGDSFTDYNLSWVKQISLEWIGVINP
NYGTTTYNQKFKAKATLTVDQSSSTAYMQLNSLTSEDSAVYYCAFSSRLF
GYWGQGTTLTVSSASTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPV
TVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHP
ASSTKVDKKIVPR
Ligand information
>6pdr Chain A (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGIGAVF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pdr Modular recognition of antigens provides a mechanism that improves vaccine-elicited antibody-class frequencies
Resolution1.555 Å
Binding residue
(original residue number in PDB)		N33 V50 S95 S96 R97 L98 F99 W103
Binding residue
(residue number reindexed from 1)		N33 V47 S96 S97 R98 L99 F100 W103
External links