Structure of PDB 6o42 Chain H Binding Site BS01

Receptor Information
>6o42 Chain H (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGG
IIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCAREG
EGWFGKPLRAFEFWGQGTVITVSSASTKGPSVFPLAPSGGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKKVEPK
Ligand information
>6o42 Chain G (length=15) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NWFDITNWLWYIKKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o42 An MPER antibody neutralizes HIV-1 using germline features shared among donors.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		S31 G50 I52 I53 F54 N58 E95 G100A K100B P100C R100E
Binding residue
(residue number reindexed from 1)		S31 G50 I52 I54 F55 N59 E99 G105 K106 P107 R109
External links