Structure of PDB 6mv5 Chain H Binding Site BS01

Receptor Information
>6mv5 Chain H (length=210) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVKLEESGGGLVQPGGSMKLSCVASRFTLSKYWMNWVRQSPEKGLEWVAQ
IRLKSDNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTG
EIFVNWGQGTLVTVSAASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSN
TKVDKKVEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mv5 Identification of a Helical Segment within the Intrinsically Disordered Region of the PCSK9 Prodomain.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		E1 S25 R26 F27 T28 K31 Y32 W33 R52 D53 E95 I96
Binding residue
(residue number reindexed from 1)		E1 S25 R26 F27 T28 K31 Y32 W33 R52 D56 E101 I102
External links