Structure of PDB 6mup Chain H Binding Site BS01

Receptor Information
>6mup Chain H (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Ligand information
>6mup Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcgaggaagttcatataaaaggcaaacggaagcattctcagaatattct
ttgtgatgatggagtttcactcacagagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatatttgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mup Structure of the Human Core Centromeric Nucleosome Complex.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
Y42 S55 S56 R86 S87 T88
Binding residue
(residue number reindexed from 1)
Y10 S23 S24 R54 S55 T56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:6mup, PDBe:6mup, PDBj:6mup
PDBsum6mup
PubMed31353180
UniProtQ5QNW6|H2B2F_HUMAN Histone H2B type 2-F (Gene Name=H2BC18)

[Back to BioLiP]