Structure of PDB 6mtt Chain H Binding Site BS01

Receptor Information
>6mtt Chain H (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGSEVKKPGSSVKVSCKASGGTFSTYTFSWVRQGLEWLGGILPL
LNIANYAQKFQGRVKFAADKSTNMAYMELSGLRSDDTAVYYCARHSNSWF
SPKWYFDVWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKKVEPK
Ligand information
>6mtt Chain P (length=19) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KWASLWNWFDITKWLWYIK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mtt Longitudinal Analysis Reveals Early Development of Three MPER-Directed Neutralizing Antibody Lineages from an HIV-1-Infected Individual.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		T33 G50 I51 L52 N55 I56 A57 N58 Y59 K68 F69 A70 H95 N97 S98 W99 P100B W100D
Binding residue
(residue number reindexed from 1)		T33 G46 I47 L48 N52 I53 A54 N55 Y56 K65 F66 A67 H95 N97 S98 W99 P102 W104
External links