Structure of PDB 6mtp Chain H Binding Site BS01

Receptor Information
>6mtp Chain H (length=218) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RVQLVQSGAEVKKPGSSVRISCKASGGTFSTLTLTWVRQAPGQGLEWMGG
IIPLLSLPNYTQKFQGRLTITADTSTSTSYLELSSLRSEDTAVYFCAREA
SGWFDKPLGAMGVWGQGTMVVVSSASTKGPSVFPLAPGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC
NVNHKPSNTKVDKKVEPK
Ligand information
>6mtp Chain P (length=18) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ASLWNWFDITKWLWYIKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mtp Longitudinal Analysis Reveals Early Development of Three MPER-Directed Neutralizing Antibody Lineages from an HIV-1-Infected Individual.
Resolution2.036 Å
Binding residue
(original residue number in PDB)		T31 T33 I52 L56 N58 E95 D100A K100B P100C
Binding residue
(residue number reindexed from 1)		T31 T33 I52 L57 N59 E99 D105 K106 P107
External links