Structure of PDB 6ldy Chain H Binding Site BS01

Receptor Information

>6ldy Chain H (length=211) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QTVKESGGRLVTPGGTLTLTCTVSGFSLSRYAMSWVRQAPGEGLEYIGWI
NTYGSAYYASWVNGRFTISKTSTTMDLKMTSLTAADTATYFCVRWFADGG
MDPWGPGTLVTVSSGQPKAPSVFPLAPCCGDTPSSTVTLGCLVKGYLPEP
VTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPA
TNTKVDKTVAP

Ligand information

>6ldy Chain M (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EKFGKGGTYP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6ldy Structural basis for antigen recognition by methylated lysine-specific antibodies.
Resolution	1.77 Å
Binding residue (original residue number in PDB)	R30 W49 N51 T52 Y53 W95 F96 A97 D98
Binding residue (residue number reindexed from 1)	R30 W49 N51 T52 Y53 W95 F96 A97 D98

External links

PDB	RCSB:6ldy, PDBe:6ldy, PDBj:6ldy
PDBsum	6ldy
PubMed	33303630

[Back to BioLiP]