Structure of PDB 6ldx Chain H Binding Site BS01

Receptor Information
>6ldx Chain H (length=214) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDQSLEESGGRLVTPGTPLTLTCTVSGFSLNNNAMGWFRQAPGEGLEWIG
AIYTDGSTYYASWAKGRFTISKTSTTIDLKMTSLTTEDTATYFCARHGYT
YSFNLWGPGTLVTVSSGQPKAPSVFPLAPCCGDTPSSTVTLGCLVKGYLP
EPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAH
PATNTKVDKTVAPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ldx Structural basis for antigen recognition by methylated lysine-specific antibodies.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Q1 N30 N31 A32 Y51 T52 R94 H95 G96 Y97 T98 Y99 N102
Binding residue
(residue number reindexed from 1)		Q3 N32 N33 A34 Y53 T54 R96 H97 G98 Y99 T100 Y101 N104
External links