Structure of PDB 6ldi Chain H Binding Site BS01

Receptor Information

>6ldi Chain H (length=128) Species: 83333 (Escherichia coli K-12)

MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLL
RQARQVGFNLEESGELVNLFNDPQRHSADVKRRTLEKVAEIERHIEELQS
MRDQLLALANACPGDDSADCPIIENLSG

Ligand information

>6ldi Chain 1 (length=50)

cttgaccttccccttgctggaaggtttataatgggagctgtcacggatgc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6ldi CueR activates transcription through a DNA distortion mechanism.
• Resolution: 3.69 Å
• Binding residue (original residue number in PDB): I3 S4 R18 Y36 R37
• Binding residue (residue number reindexed from 1): I3 S4 R18 Y36 R37

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0000987 cis-regulatory region sequence-specific DNA binding
• GO:0001216 DNA-binding transcription activator activity
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005507 copper ion binding
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006351 DNA-templated transcription
• GO:0006355 regulation of DNA-templated transcription
• GO:0045893 positive regulation of DNA-templated transcription

Cellular Component

• GO:0005737 cytoplasm
• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:6ldi, PDBe:6ldi, PDBj:6ldi
• PDBsum: 6ldi
• PubMed: 32989300
• UniProt: P0A9G4|CUER_ECOLI HTH-type transcriptional regulator CueR (Gene Name=cueR)