Structure of PDB 6lb3 Chain H Binding Site BS01

Receptor Information

>6lb3 Chain H (length=95) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GMRPIHPGEILRDEFLMEFDISPAALARALKVSAPTVNDIVREQRGISAD
MAIRLGRYFDTSAQFWMNLQSEYSLATAYAANGKQIEHEIEPLLA

Ligand information

>6lb3 Chain J (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acccttaacgttaagcgt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6lb3 Crystal structure of PA4674 in complex with its operator DNA (18bp) from Pseudomonas aeruginosa
Resolution	2.497 Å
Binding residue (original residue number in PDB)	S37 R49 G50 S52
Binding residue (residue number reindexed from 1)	S33 R45 G46 S48

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:6lb3, PDBe:6lb3, PDBj:6lb3
PDBsum	6lb3
PubMed
UniProt	Q9HVC1

[Back to BioLiP]