Structure of PDB 6kvf Chain H Binding Site BS01

Receptor Information
>6kvf Chain H (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLVQSGAEVKKPGSSVKVSCKASLSSYAISWVRQAPGQGPEWMGWINPN
SGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRPDDTAVYYCASGYCSST
SCYDYWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTV
SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKP
SNTKVDKKVEPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kvf Selection of a picomolar antibody that targets CXCR2-mediated neutrophil activation and alleviates EAE symptoms.
Resolution2.79 Å
Binding residue
(original residue number in PDB)		Y33 A34 S36 W51 N53 G100 Y101 C102 W111
Binding residue
(residue number reindexed from 1)		Y28 A29 S31 W46 N48 G95 Y96 C97 W106
External links