Structure of PDB 6kiw Chain H Binding Site BS01

Receptor Information
>6kiw Chain H (length=94) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTCYTSAK
Ligand information
>6kiw Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcggatgtatatatctgacacgtgcctggagactagggagtaatcccctt
ggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kiw Structural basis of nucleosome recognition and modification by MLL methyltransferases.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		R30 I51 S52 S53 S84
Binding residue
(residue number reindexed from 1)		R2 I23 S24 S25 S56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6kiw, PDBe:6kiw, PDBj:6kiw
PDBsum6kiw
PubMed31485071
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]