Structure of PDB 6iy2 Chain H Binding Site BS01

Receptor Information
>6iy2 Chain H (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEAS
RLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>6iy2 Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atctgcaacagtcctaacattcacctcttgtgtgtttgtgtctgttcgcc
atcccgtctccgctcgtcacttatccttcactttccagagggtccccccg
cagaccccggcgaccctcaggtcggccgactgcggcacagttttgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6iy2 Mechanism of DNA translocation underlying chromatin remodelling by Snf2.
Resolution3.47 Å
Binding residue
(original residue number in PDB)		K31 I39 Y40
Binding residue
(residue number reindexed from 1)		K3 I11 Y12
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6iy2, PDBe:6iy2, PDBj:6iy2
PDBsum6iy2
PubMed30867599
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]