Structure of PDB 6ifm Chain H Binding Site BS01

Receptor Information
>6ifm Chain H (length=68) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MHTTLFFSNRTQAVRLPKSISFPEDVKHVEIIAVGRSRIITPVGESWDSW
FDGEGASTDFMSTREQPA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ifm Crystal structure of proteolyzed VapBC and DNA-bound VapBC from Salmonella enterica Typhimurium LT2 and VapC as a putative Ca2+-dependent ribonuclease.
Resolution2.804 Å
Binding residue
(original residue number in PDB)		T4 N9 R15 K18
Binding residue
(residue number reindexed from 1)		T4 N9 R15 K18
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6ifm, PDBe:6ifm, PDBj:6ifm
PDBsum6ifm
PubMed31908032
UniProtQ7CPV2|VAPB_SALTY Antitoxin VapB (Gene Name=vapB)

[Back to BioLiP]