Structure of PDB 6gk7 Chain H Binding Site BS01

Receptor Information
>6gk7 Chain H (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGPEMRKPGESLKISCKTSGYIFSDYWTAWVRQLPGKGLQWMGI
IYSGDSDTRYHPSVQGHVTMSTDSSLTTAYLQWSSLKASDTGIYYCARLD
ARVDAGWQLDSWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL
VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKRVEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gk7 A common antigenic motif recognized by naturally occurring human VH5-51/VL4-1 anti-tau antibodies with distinct functionalities.
Resolution2.95 Å
Binding residue
(original residue number in PDB)		W33 I50 Y52 D55 D57 R59 A101 W107
Binding residue
(residue number reindexed from 1)		W33 I50 Y52 D55 D57 R59 A101 W107
External links