Structure of PDB 6fzr Chain H Binding Site BS01

Receptor Information
>6fzr Chain H (length=226) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAE
IRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTG
VGQFAYWGQGTTVTVSDIVVTQESALTTSPGETVTLTCRSSTGAVTTSNY
ANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTED
EAIYFCALWYSNHWVFGGGTKLTVLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fzr Water Sculpts the Distinctive Shapes and Dynamics of the Tumor-Associated Carbohydrate Tn Antigens: Implications for Their Molecular Recognition.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		N31 Y32 W33 Q103 Y1041 W1100
Binding residue
(residue number reindexed from 1)		N31 Y32 W33 Q103 Y150 W209
External links