Structure of PDB 6fy0 Chain H Binding Site BS01

Receptor Information
>6fy0 Chain H (length=226) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVQSGAEVKKPGESLKISCKGSGYRFPSSWIGWVRQVPGKGLEWMGI
IYPGDGETRYRASFQGQVTISADQSSNTAYLQWSSLKASDTAMYYCARHG
RGVREVINAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC
LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG
TQTYICNVNHKPSNTKVDKKVEPKSC
Ligand information
>6fy0 Chain P (length=17) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RDKKQKAYALFYRPDVV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fy0 V2-Directed Vaccine-like Antibodies from HIV-1 Infection Identify an Additional K169-Binding Light Chain Motif with Broad ADCC Activity.
Resolution2.57 Å
Binding residue
(original residue number in PDB)		R28 P30 W33 Y52 D54 E56 R58 H95 G96 R97 G98 N100D
Binding residue
(residue number reindexed from 1)		R28 P30 W33 Y52 D55 E57 R59 H99 G100 R101 G102 N108
External links