Structure of PDB 6e4z Chain H Binding Site BS01

Receptor Information
>6e4z Chain H (length=209) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVKLEESGGGLVQPGGSMKLSCVASRFTLSKYWMNWVRQSPEKGLEWVAQ
IRLKSDNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTG
EIFVNWGQGTLVTVSAASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWN
SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNT
KVDKKVEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6e4z Identification of a Helical Segment within the Intrinsically Disordered Region of the PCSK9 Prodomain.
Resolution2.202 Å
Binding residue
(original residue number in PDB)		F27 K31 Y32 W33 D53 G94 E95 I96 V98 N99
Binding residue
(residue number reindexed from 1)		F27 K31 Y32 W33 D56 G100 E101 I102 V104 N105
External links