Structure of PDB 6df2 Chain H Binding Site BS01

Receptor Information

>6df2 Chain H (length=219) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVQLVESGGGLVQPGGSLRLSCAASGYTFTENTVHWVRQAPGKGLEWIGG
INPYYGGSIFSPKFKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARRA
GAYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY
FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI
CNVNHKPSNTKVDKKVEPK

Ligand information

>6df2 Chain D (length=3) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LYL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6df2 Engineering Improved Antiphosphotyrosine Antibodies Based on an Immunoconvergent Binding Motif.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	T33 H35 N52 Y54 G56 I58 R95
Binding residue (residue number reindexed from 1)	T33 H35 N52 Y55 G57 I59 R99

External links

PDB	RCSB:6df2, PDBe:6df2, PDBj:6df2
PDBsum	6df2
PubMed	30398859

[Back to BioLiP]