Structure of PDB 6ddd Chain H Binding Site BS01

Receptor Information
>6ddd Chain H (length=93) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASLKSIIRQGKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKV
IREVGRNGVIELGVGSKTIKVMVADYQFDPLKNQITHIDFLAI
Ligand information
>6ddd Chain 2 (length=104) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugacuauagcaaggaggucacaccuguucccaugccgaacacagaaguu
aagcuccuuagcgucgaugguagucgaacuuacguuccgcuagaguagaa
cguu
<........<<<<<<<<.....<<<<<...............>>>..>>.
...>>>>>>.>>.<...<....<..<........>..>.....>..>...
...>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ddd cryoEM-Guided Development of Antibiotics for Drug-Resistant Bacteria.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R9 R15 S16 K19 R22 Y32 N38 D76 Q78 H88
Binding residue
(residue number reindexed from 1)		R8 R14 S15 K18 R21 Y31 N37 D75 Q77 H87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ddd, PDBe:6ddd, PDBj:6ddd
PDBsum6ddd
PubMed30667174
UniProtP0A0F8|RL15_STAA8 Large ribosomal subunit protein uL15 (Gene Name=rplO)

[Back to BioLiP]