Structure of PDB 6db6 Chain H Binding Site BS01

Receptor Information
>6db6 Chain H (length=226) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKKPGASVKISCKASGYNFTTYAMHWVRQAPGQGLEWMGW
INGGNGDTRYSQKFRGRVTISRDTSASTAYMELHSLTSEDTALFYCARES
GDYYSEISGALDWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC
LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG
TQTYICNVNHKPSNTKVDKRVEPKSC
Ligand information
>6db6 Chain P (length=14) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RKRIHIGPGRAFYT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6db6 Structural Comparison of Human Anti-HIV-1 gp120 V3 Monoclonal Antibodies of the Same Gene Usage Induced by Vaccination and Chronic Infection.
Resolution1.978 Å
Binding residue
(original residue number in PDB)		W50 N52 D56 R58 G97 D98 Y99
Binding residue
(residue number reindexed from 1)		W50 N52 D57 R59 G101 D102 Y103
External links