Structure of PDB 6d6v Chain H Binding Site BS01

Receptor Information
>6d6v Chain H (length=108) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NCLIKIINIPQGTLKAEVVLAVRHLGYEFYCDYIDGQAMIRFQNSDEQRL
AIQKLLNHNNNKLQIEIRGQICDVISTIPEDEEKNYWNYIKFKKNEFRKF
FFMKKQQK
Ligand information
>6d6v Chain B (length=159) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auacccgcuuaauucauucagaucuguaauagaacugucauucaacccca
aaaaucuagugcugauauaaccuucaccaauuagguucaaauaaguggua
augcgggacaaaagacuaucgacauuugauacacuauuuaucaauggaug
ucuuauuuu
...<<<<<..........<<<..<<.....>>..>>>.............
...................(((...<<<<.<<<))).....>>>.>>>>.
..>>>>>.....<<<<.<<<...<<.<<<<.........>>>>>>.>>>>
>>>......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6d6v Structure of Telomerase with Telomeric DNA.
Resolution4.8 Å
Binding residue
(original residue number in PDB)		K392 A393 V396 R400 Y407 I514 K517 K518 E520 F521 R522 F526 K528
Binding residue
(residue number reindexed from 1)		K15 A16 V19 R23 Y30 I90 K93 K94 E96 F97 R98 F102 K104
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0070034 telomerase RNA binding
Biological Process
GO:0007004 telomere maintenance via telomerase
GO:0090669 telomerase RNA stabilization
GO:1904868 telomerase catalytic core complex assembly
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005694 chromosome
GO:0005697 telomerase holoenzyme complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6d6v, PDBe:6d6v, PDBj:6d6v
PDBsum6d6v
PubMed29775593
UniProtW7X6T2|LARP7_TETTS La-related protein 7 homolog (Gene Name=TAP65)

[Back to BioLiP]