Structure of PDB 6ct7 Chain H Binding Site BS01

Receptor Information

>6ct7 Chain H (length=214) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVQLVESGGGLVEPGGSLRLSCAVSGFDFEKAWMSWVRQAPGQGLQWVAR
IKSTADGGTTSYAAPVEGRFIISRDDSRNMLYLQMNSLKTEDTAVYYCTS
AHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH
KPSNTKVDKRVEPK

Ligand information

>6ct7 Chain S (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MDVFMKGLSK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6ct7 Development of an aggregate-selective, human-derived alpha-synuclein antibody BIIB054 that ameliorates disease phenotypes in Parkinson's disease models.
Resolution	1.903 Å
Binding residue (original residue number in PDB)	F27 A32 W33 S100 H102
Binding residue (residue number reindexed from 1)	F27 A32 W33 S100 H102

External links

PDB	RCSB:6ct7, PDBe:6ct7, PDBj:6ct7
PDBsum	6ct7
PubMed	30381260

[Back to BioLiP]