Structure of PDB 6cez Chain H Binding Site BS01

Receptor Information
>6cez Chain H (length=222) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QELVESGGGLVQPGGSLKLSCKASGIDFNNCGVTWVRQAPGQGLEWIAYI
YTGLGVGHYASSVEGRFTVSSDNAQNAVFLQMTSLTASDTATYFCARDGV
MSGVEGYYFNLWGPGTLVTVSSGQPKAPSVFPLAPCCGDTPSSTVTLGCL
VKGYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPV
TCNVAHPATNTKVDKTVAPSTC
Ligand information
>6cez Chain P (length=14) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RDKVQKEYALFYKL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cez Select gp120 V2 domain specific antibodies derived from HIV and SIV infection and vaccination inhibit gp120 binding to alpha 4 beta 7.
Resolution2.399 Å
Binding residue
(original residue number in PDB)		G33 Y50 Y52 V56 H58 D95 G100 Y100D
Binding residue
(residue number reindexed from 1)		G32 Y49 Y51 V56 H58 D98 G103 Y107
External links