Structure of PDB 6bzy Chain H Binding Site BS01

Receptor Information
>6bzy Chain H (length=214) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLLESGPGLVAPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEWLGA
IWSAGNTNYNSALMSRLSISRDNSKSQVFLKMNSLQTDDTAMYYCACAPI
YYDYTWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSMVTLGCLVKGYFPEP
VTVTWNSGSLTSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAH
PASSTKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bzy Immunogenetic and structural analysis of a class of HCV broadly neutralizing antibodies and their precursors.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		W52 S53 A54 N56 I96A Y96B Y97 W100A
Binding residue
(residue number reindexed from 1)		W52 S53 A54 N56 I100 Y101 Y102 W106
External links