Structure of PDB 6bzu Chain H Binding Site BS01

Receptor Information

>6bzu Chain H (length=215) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LVLTQSPASLTVSLGQRATMSCRSSESVDAHGYSFLHWYQQKPGQPPKLL
IYLASNLESGVPARFSGSGSRTDFTLTIDPVEADDAATYSCLKNNEDPWT
FGGGTKLEITRADAAPTVSIFPPSSEQLTSGTASVVCLLNNFYPREAKVQ
WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRG

Ligand information

>6bzu Chain L (length=12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

QLINTNGSWHIN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6bzu Immunogenetic and structural analysis of a class of HCV broadly neutralizing antibodies and their precursors.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	H28 F32 N91 N92 E93 W96
Binding residue (residue number reindexed from 1)	H31 F35 N94 N95 E96 W99

External links

PDB	RCSB:6bzu, PDBe:6bzu, PDBj:6bzu
PDBsum	6bzu
PubMed	29954862

[Back to BioLiP]