Structure of PDB 6bqb Chain H Binding Site BS01

Receptor Information
>6bqb Chain H (length=222) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVQLVESGGGVVQPGRSLRLSCAASGFRFSDYGMHWVRQAPGKGLEWVAL
IWYDGSNESYLDSVKGRFTISRDNSKNTLYLQMNNLRTEDTAVYYCAKLL
VGITTDVFDVWGQGTVVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYICNVNHKPSNTKVDKRVEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bqb A public antibody lineage that potently inhibits malaria infection through dual binding to the circumsporozoite protein.
Resolution1.769 Å
Binding residue
(original residue number in PDB)		D31 Y32 G33 W52 Y52A V97 G98
Binding residue
(residue number reindexed from 1)		D31 Y32 G33 W52 Y53 V101 G102
External links