Structure of PDB 6bj8 Chain H Binding Site BS01

Receptor Information

>6bj8 Chain H (length=242) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASE
GTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASRTRGGTLIE
QYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYP
DHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYCLSSRLRVSATFWQ
NPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD

Ligand information

>6bj8 Chain C (length=9) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VPLTEDAEL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6bj8 Isolation of a Structural Mechanism for Uncoupling T Cell Receptor Signaling from Peptide-MHC Binding.
Resolution	1.75 Å
Binding residue (original residue number in PDB)	R94 R96 G97
Binding residue (residue number reindexed from 1)	R92 R94 G95

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:6bj8, PDBe:6bj8, PDBj:6bj8
PDBsum	6bj8
PubMed	30053426
UniProt	K7N5M4

[Back to BioLiP]