Structure of PDB 6bgo Chain H Binding Site BS01

Receptor Information

>6bgo Chain H (length=215) Species: 1773 (Mycobacterium tuberculosis)

SPEQAMRERSELARKGIARAKSVVALAYAGGVLFVAENPSRSLQKISELY
DRVGFAAAGKFNEFDNLRRGGIQFADTRGYAYDRRDVTGRQLANVYAQTL
GTIFTEQAKPYEVELCVAEVAHYGETKRPELYRITYDGSIADEPHFVVMG
GTTEPIANALKESYAENASLTDALRIAVAALRALGVASLEVAVLDANRPR
RAFRRITGSALQALL

Ligand information

>6bgo Chain g (length=4) Species: 1773 (Mycobacterium tuberculosis)

GQYL

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6bgo Proteasome substrate capture and gate opening by the accessory factor PafE fromMycobacterium tuberculosis.
• Resolution: 4.2 Å
• Binding residue (original residue number in PDB): R26 A27 K52 G66
• Binding residue (residue number reindexed from 1): R19 A20 K45 G59

Enzymatic activity

• Enzyme Commision number: 3.4.25.1: proteasome endopeptidase complex.

Gene Ontology

Molecular Function

• GO:0004175 endopeptidase activity
• GO:0004298 threonine-type endopeptidase activity
• GO:0005515 protein binding
• GO:0016787 hydrolase activity

Biological Process

• GO:0010498 proteasomal protein catabolic process
• GO:0019941 modification-dependent protein catabolic process
• GO:0030682 symbiont-mediated perturbation of host defenses
• GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
• GO:0051603 proteolysis involved in protein catabolic process

Cellular Component

• GO:0000502 proteasome complex
• GO:0005737 cytoplasm
• GO:0005839 proteasome core complex
• GO:0005886 plasma membrane
• GO:0009274 peptidoglycan-based cell wall
• GO:0019773 proteasome core complex, alpha-subunit complex

External links

• PDB: RCSB:6bgo, PDBe:6bgo, PDBj:6bgo
• PDBsum: 6bgo
• PubMed: 29414791
• UniProt: P9WHU1|PSA_MYCTU Proteasome subunit alpha (Gene Name=prcA)