Structure of PDB 6b5t Chain H Binding Site BS01

Receptor Information
>6b5t Chain H (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVQLVQSGSELKKPGASVKVSCKTSGYTFTTYAMNWVRQAPGQGLEWMGW
INTNTGNPTYAPGFTGRFVFSFDTSVSTAYLQISSLKAEDTAVYYCARVY
SYGVPFDYWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVT
VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHK
PSNTKVDKKVEP
Ligand information
>6b5t Chain A (length=13) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ANPNANPNANPNA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b5t A human monoclonal antibody prevents malaria infection by targeting a new site of vulnerability on the parasite.
Resolution2.222 Å
Binding residue
(original residue number in PDB)		T31 Y32 A33 N52 T52A N53 S97 Y98 G99
Binding residue
(residue number reindexed from 1)		T31 Y32 A33 N52 T53 N54 S101 Y102 G103
External links