Structure of PDB 6b5o Chain H Binding Site BS01

Receptor Information
>6b5o Chain H (length=222) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVQLVQSGAEVKKPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGW
IKAGNGNTRYSQKFQDRVTITRDTSTTTAYMELSSLRSEDTAVYYCALLT
VLTPDDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYICNVNHKPSNTKVDKKVEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b5o A human monoclonal antibody prevents malaria infection by targeting a new site of vulnerability on the parasite.
Resolution2.194 Å
Binding residue
(original residue number in PDB)		A33 H35 W50 L95 T96 V97 L98
Binding residue
(residue number reindexed from 1)		A33 H35 W50 L99 T100 V101 L102
External links