Structure of PDB 6b5n Chain H Binding Site BS01

Receptor Information
>6b5n Chain H (length=222) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVQLVQSGAEVKKPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGW
IKAGNGNTRYSQKFQDRVTITRDTSTTTAYMELSSLRSEDTAVYYCALLT
VLTPDDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYICNVNHKPSNTKVDKKVEPK
Ligand information
>6b5n Chain A (length=11) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NVDPNANPNVD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b5n A human monoclonal antibody prevents malaria infection by targeting a new site of vulnerability on the parasite.
Resolution1.98 Å
Binding residue
(original residue number in PDB)		A33 H35 W50 K52 R58 L95 T96 V97 L98
Binding residue
(residue number reindexed from 1)		A33 H35 W50 K52 R59 L99 T100 V101 L102
External links