Structure of PDB 6b5m Chain H Binding Site BS01

Receptor Information
>6b5m Chain H (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLVQSGAEVKKPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGWI
KAGNGNTRYSQKFQDRVTITRDTSTTTAYMELSSLRSEDTAVYYCALLTV
LTPDDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKKVEP
Ligand information
>6b5m Chain A (length=13) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NPDPNANPNVDPN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b5m A human monoclonal antibody prevents malaria infection by targeting a new site of vulnerability on the parasite.
Resolution1.79 Å
Binding residue
(original residue number in PDB)		Y32 A33 H35 W50 K52 R58 L95 T96 V97 L98 P100
Binding residue
(residue number reindexed from 1)		Y31 A32 H34 W49 K51 R58 L98 T99 V100 L101 P103
External links