Structure of PDB 6b5l Chain H Binding Site BS01

Receptor Information
>6b5l Chain H (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLVQSGAEVKKPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGWI
KAGNGNTRYSQKFQDRVTITRDTSTTTAYMELSSLRSEDTAVYYCALLTV
LTPDDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKKVEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b5l A human monoclonal antibody prevents malaria infection by targeting a new site of vulnerability on the parasite.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		A33 H35 W50 R58 L95 T96 V97 L98
Binding residue
(residue number reindexed from 1)		A32 H34 W49 R58 L98 T99 V100 L101
External links