Structure of PDB 6avf Chain H Binding Site BS01

Receptor Information
>6avf Chain H (length=269) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAP
WIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYG
CDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAA
REAEQRRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQR
YTCHVQHEGLPKPLTLRWE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6avf Divergent T-cell receptor recognition modes of a HLA-I restricted extended tumour-associated peptide.
Resolution2.028 Å
Binding residue
(original residue number in PDB)		Y7 R62 N63 Q70 T73 S77 N80 Y84 Y99 D114 Y116 Y123 T143 W147 E152 Q155 R156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 R62 N63 Q70 T73 S77 N80 Y84 Y99 D114 Y116 Y123 T143 W147 E152 Q155 R156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation

View graph for
Biological Process
External links
PDB RCSB:6avf, PDBe:6avf, PDBj:6avf
PDBsum6avf
PubMed29531227
UniProtP01889|HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain (Gene Name=HLA-B)

[Back to BioLiP]