Structure of PDB 6aso Chain H Binding Site BS01

Receptor Information

>6aso Chain H (length=83) Species: 4932 (Saccharomyces cerevisiae)

SATLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRKEFICKA
QLLRGSEIALVKDTKNKIENEHVIWEKVYESKT

Ligand information

>6aso Chain I (length=70)

caauuugaaacaauacagagaugaucagcgguuccccugcauaaggggaa
ccguuuuacaaagaguuuuu

...<<<<...................<<<<<<<<<<<<.....>>>>>>>
>>>>>...>>>>........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6aso Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
• Resolution: 2.71 Å
• Binding residue (original residue number in PDB): N35 R57 G58 S59 T89
• Binding residue (residue number reindexed from 1): N34 R54 G55 S56 T64

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006364 rRNA processing
• GO:0006397 mRNA processing
• GO:0008033 tRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005688 U6 snRNP
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0032991 protein-containing complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071001 U4/U6 snRNP
• GO:0071011 precatalytic spliceosome

External links

• PDB: RCSB:6aso, PDBe:6aso, PDBj:6aso
• PDBsum: 6aso
• PubMed: 29717126
• UniProt: P47093|LSM8_YEAST U6 snRNA-associated Sm-like protein LSm8 (Gene Name=LSM8)