Structure of PDB 5zv3 Chain H Binding Site BS01

Receptor Information
>5zv3 Chain H (length=219) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQQSGAEVKKPGESLKISCEASGYSFTNYWIGWVRQMPGKGLEWMGI
IYPGDSDTRYSPPFQGQVTITADRSITTAYLEWSSLKASDTAMYYCARVG
RPSKGGWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYICNVNHKPSNTKVDKRV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zv3 A common antigenic motif recognized by naturally occurring human VH5-51/VL4-1 anti-tau antibodies with distinct functionalities.
Resolution2.093 Å
Binding residue
(original residue number in PDB)		W33 Y52 D54 D56 R58 R97 S99 K100 G100A
Binding residue
(residue number reindexed from 1)		W33 Y52 D55 D57 R59 R101 S103 K104 G105
External links