Structure of PDB 5z3g Chain H Binding Site BS01

Receptor Information
>5z3g Chain H (length=256) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIPRERVIKAVNELIKFTSKPEEELKKDLQLIVVNNKSFTGTSKSFKLKL
LNVKHSFYKPWKEASATAVKDFKVLLILKDSDIKKVSEDDLFDQLDSEGI
KVDEIICGKDLKTVYKAYEARNAFISQFSLILADDSIVTSLPKLMGGKAY
NKVETTPISIRTHANKEFSLTTLTNNIKKVYMNQLPVKLPRGTTLNVHLG
NLEWLRPEEFVDNVELISEQLIKAYQIRSIFIKTNRSPVLPLYYNQDVLD
ELEAKK
Ligand information
>5z3g Chain C (length=65) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccuucucaaacauucuguuugguagugagugauacucuuuggaguuaacu
ugaaauugccuuaaa
......<<<<<.....>>>>>.....<<<<...<<<......>>>..>>>
>..............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5z3g Cryo-EM structure of an early precursor of large ribosomal subunit reveals a half-assembled intermediate.
Resolution3.65 Å
Binding residue
(original residue number in PDB)		N84 K93 F95 K96 D129 K161 K165 A166 Y167 E168 D184 S185 I186 V187 T188 K192 G195 G196 K201 E203 R210 S218 T220 T221 N224 K228 R240 G241 T242 T243 N245 H247 R277 N284 R285
Binding residue
(residue number reindexed from 1)		N35 K44 F46 K47 D80 K112 K116 A117 Y118 E119 D135 S136 I137 V138 T139 K143 G146 G147 K152 E154 R161 S169 T171 T172 N175 K179 R191 G192 T193 T194 N196 H198 R228 N235 R236
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0070180 large ribosomal subunit rRNA binding
GO:0070628 proteasome binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0030163 protein catabolic process
GO:0042254 ribosome biogenesis
Cellular Component
GO:0000502 proteasome complex
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5z3g, PDBe:5z3g, PDBj:5z3g
PDBsum5z3g
PubMed29557065
UniProtP38779|CIC1_YEAST Proteasome-interacting protein CIC1 (Gene Name=CIC1)

[Back to BioLiP]